Sign In | Join Free | My dcshooter.com
dcshooter.com
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Urological Supplies >

Does Cjc 1295 Work

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    does cjc 1295 work

    All does cjc 1295 work wholesalers & does cjc 1295 work manufacturers come from members. We doesn't provide does cjc 1295 work products or service, please contact them directly and verify their companies info carefully.

    Total 2618 products from does cjc 1295 work Manufactures & Suppliers
    Buy cheap Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial from Wholesalers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Buy cheap Peptide Steroid hormones Lyophilized Powder Cjc 1295 Without Dac for Gh Releasing from Wholesalers

    Brand Name:YC

    Model Number:Cjc 1295 Without Dac

    Place of Origin:China

    ... Packing Ways for Your Choice Specification:USP28 HS Code:3001200020 Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 without DAC, CJC 1295 w/o DAC Product Description 1.CJC-1295 Peptide Profile This peptide is a GH releasing hormone (GHRH)

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Buy cheap Peptide Hormones Bodybuilding GHRH CJC-1295 with DAC For Increases Protein Synthesis from Wholesalers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    .../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Buy cheap 87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For  Muscle Gain from Wholesalers

    Brand Name:Hongkong blue

    Model Number:CJC-1295 87616-84-0

    Place of Origin:CHINA

    ...87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For Muscle Gain Why choose hongkong blue company and contact mabel ? Emai:...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Buy cheap CJC1295 Without DAC High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial 863288-34-0 from Wholesalers

    Brand Name:CJC-1295 Without DAC

    Model Number:863288-34-0

    Place of Origin:China

    ...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Buy cheap CAS 863288-34-0 Human Growth Hormone Peptide with DAC 2mg CJC-1295 DAC from Wholesalers

    Brand Name:Pharmlab

    Model Number:863288-34-0

    Place of Origin:China

    ...99% Human Growth Peptide CJC-1295 with DAC 2mg CAS 863288-34-0 for Muscle Growth CJC-1295 DAC Quick detail Product Name CJC-1295 With DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap CAS 863288-34-0 Peptides Steroids Powder Cjc-1295 No Dac for Muscle Enhance from Wholesalers

    Brand Name:HKYC

    Model Number:PEPTIDE POWDER

    Place of Origin:HUBEI,CHINA

    ...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss from Wholesalers

    Brand Name:Gear Steroids

    Model Number:51753-57-2

    Place of Origin:China

    ... 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material Reship: Available Usage: for Lean Muscle Shipping Time: 3~7 Working days Specification: USP28 HS...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Buy cheap CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection from Wholesalers

    Brand Name:Grand Uni or OEM

    Model Number:CAS:863288-34-0

    Place of Origin:China

    ...-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Drug Affinity Complex) CJC-1295 Molecular formula: C165H269N47O46 CJC-1295 Molar Mass: 3647.15 CJC-1295 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production.

    GRAND UNIVERSE INDUSTRIAL LIMITED
    Verified Supplier

    Guangdong

    Buy cheap CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 from Wholesalers

    Brand Name:YIHAN

    Model Number:CJC -1295

    Place of Origin:China

    ...CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap Muscle Mass Growth Hormone Releasing Peptide GHRH CJC-1295 With DAC 2mg from Wholesalers

    Brand Name:Blue Dragon

    Model Number:CJC-1295 With DAC 2mg

    Place of Origin:China Manufacturer

    ... GHRH Muscle Mass 1, CJC-1295 With DAC Profile: Product Name: CJC-1295 With DAC / CJC-1295 DAC Specification: 2mg per vial Synonyms: CJC1295(GHRH/DAC), CJC1295 DAC(Drug Affinity Complex), CJC-1295 with dac, CJC 1295 CAS: 863288-34-0 MF...

    Zhuhaishi Shuangbojie Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Buy cheap Human Growth Peptides CJC-1295 Acetate cjc1295 DAC 2mg/vial,863288-34-0 from Wholesalers

    Brand Name:YC

    Model Number:863288-34-0

    Place of Origin:China

    ... name: CJC-1295 Acetate Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF 1-29 CAS Registry Number: 863288-34-0 Appearance: White Powder Purity:98% Grade: Pharmaceutical Grade Storage: Shading, confined preservation CJC-1295 Effect CJC-1295 is...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Buy cheap Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC from Wholesalers

    Brand Name:Shanghai Stero

    Model Number:CJC 1295 DAC

    Place of Origin:China

    ...Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body ...

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Buy cheap CJC 1295 DAC Pharma Grade Human Growth Peptides Powder CJC1295 With DAC from Wholesalers

    Brand Name:JNJG

    Model Number:CJC-1295 with DAC

    Place of Origin:CHINA

    ...CJC 1295 DAC Pharma Grade Human Growth Peptides Powder CJC1295 With DAC other name CJC1295dac, CJC1295withDAC Product Description CJC-1295 2mg/Vial Type Immune Function AgentsGrade Standard Medicine Grad Classification Brassinosteroid MF C165H271N47O46 ...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

    Buy cheap CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production from Wholesalers

    Brand Name:NJBN STEROID

    Model Number:863288-34-0

    Place of Origin:MADE IN CHINA

    ...Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Buy cheap Purity 98% Injectable Anabolic Human Growth Bodybuliding Hormone Cjc-1295 (DAC) from Wholesalers

    Brand Name:Nanjian

    Model Number:Wuhan2017022

    Place of Origin:China

    ...)-NH2 (Drug Affinity Complex) Molecular formula: C165H269N47O46 Molar Mass: 3647.15 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone

    Tai'an Jia Ye Biological Technology Co.,Ltd
    Verified Supplier

    Buy cheap Weight Loss Growth Hormone Peptides CJC 1295 CAS 863288340 5mg / Vial With DAC from Wholesalers

    Brand Name:DW

    Model Number:863288-34-0

    Place of Origin:China

    ...Growth Hormone Peptides CJC -1295 5mg/vial With DAC For Muscle Building CAS 863288-34-0 1 . Quick Details: Product Name:CJC-1295 DAC Alias: CJC1295(GHRH/DAC) Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr...

    Doublewin Biological Technology Co., Ltd.
    Verified Supplier

    Guangxi

    Buy cheap Injectable Human Growth Hormone Steroid CJC 1295 With DAC Peptide 863288-34-0 from Wholesalers

    Brand Name:GB

    Place of Origin:China

    ... Hormone Steroid CJC 1295 With DAC Peptide 863288-34-0 Products Name CJC 1295 with DAC CAS No 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Appearance White powder Alias CJC-1295 Acetate...

    Hubei God bull Pharmaceutical Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap CJC-1295 Acetate Human Growth Peptides 98.0% white powder  863288-34-0 from Wholesalers

    Brand Name:ChineseHormone

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 Acetate Human Growth Peptides 98.0% white powder 863288-34-0 CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog. Description : One of the advantages of CJC-1295 over...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Buy cheap BodyBuilding Hormones Peptide CJC 1295 2mg per vial High purity For Gain muscles from Wholesalers

    Brand Name:CJC-1295

    Model Number:CAS Number 863288-34-0

    Place of Origin:China

    ... analog. That is to say, it works in the same way as GHRH, and may be referred to as being a GHRH. The principal use of CJC-1295 is to provide increased GH levels...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Go to Page
    Inquiry Cart 0